PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRAES3BF024100110CFD_t1
Common NameTAA_ctg0091b.00070.1, TRAES_3BF024100110CFD_c1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family MYB
Protein Properties Length: 296aa    MW: 32892.8 Da    PI: 6.2376
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRAES3BF024100110CFD_t1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding43.76.4e-142976148
                             TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
          Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                             rg+WT eEd ll+  ++ +G g+W+  a   g++Rt+k+c++rw++yl
  TRAES3BF024100110CFD_t1 29 RGPWTMEEDALLAGHIAAHGEGRWNELACAAGLRRTGKSCRLRWLNYL 76
                             89********************************************97 PP

2Myb_DNA-binding51.62.2e-1682125146
                              TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
          Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                              rg +T++E++l+++++ ++G++ W++Iar+m+ gRt++++k++w++
  TRAES3BF024100110CFD_t1  82 RGDFTPQEQLLILELHFRWGSR-WSRIAREMP-GRTDNEIKNYWRT 125
                              899*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.6842476IPR017930Myb domain
SuperFamilySSF466896.36E-2926123IPR009057Homeodomain-like
SMARTSM007171.4E-92878IPR001005SANT/Myb domain
PfamPF002499.1E-132976IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.7E-213083IPR009057Homeodomain-like
CDDcd001673.13E-73176No hitNo description
PROSITE profilePS5129420.87777131IPR017930Myb domain
SMARTSM007177.5E-1481129IPR001005SANT/Myb domain
PfamPF002494.6E-1582125IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.6E-2284130IPR009057Homeodomain-like
CDDcd001672.34E-1085125No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 296 aa     Download sequence    Send to blast
MDAVWMGSCG WPAAAATTGG EQEAVDLRRG PWTMEEDALL AGHIAAHGEG RWNELACAAG  60
LRRTGKSCRL RWLNYLRPDV RRGDFTPQEQ LLILELHFRW GSRWSRIARE MPGRTDNEIK  120
NYWRTRVQKH AKQLKCDVDS RQFRDVMRHL WMPRLVERIQ AATAMPAPSL EHAASPVYPL  180
SVAPACRGGV GMCHSPETST VTTSSTAGSS VSLEVHFPSN QLVLTAGSGT NWSGSGSEQC  240
GSGSARSEDM FDGSWSELLA RACDDGADSV VFPDFELGES RDDKWSLEDI WLQHQY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C7e-242612924126MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFN5644280.0FN564428.1 Triticum aestivum chromosome 3B-specific BAC library, contig ctg0091b.
GenBankHG6703060.0HG670306.1 Triticum aestivum chromosome 3B, genomic scaffold, cultivar Chinese Spring.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003565694.21e-124PREDICTED: transcription factor MYB24-like
TrEMBLD8L9I20.0D8L9I2_WHEAT; Myb-like DNA-binding domain containing protein,expressed
STRINGMLOC_66662.11e-167(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP19838330
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G48000.14e-76myb domain protein 112
Publications ? help Back to Top
  1. Choulet F, et al.
    Megabase level sequencing reveals contrasted organization and evolution patterns of the wheat gene and transposable element spaces.
    Plant Cell, 2010. 22(6): p. 1686-701
    [PMID:20581307]
  2. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]